Protein coding transcript 130263

• Transcript: Ll_transcript_140235
• CDS coordinates: 75-536 (+)
• Peptide sequence: MEYNIPNPISKGVNRNKRVKLSTDPQSVAARERRHRISDRFKILQSMVPGGSKMDTVSMLEEAIHYVKFLKTQICLHQKMINFVDDSSLIMLPPQKCFPHEENIISIQQQNSSVSVDFLHTLVPQISMEEQCCFQGEDNTIVTMDDNMKYWPA*
• ORF Type: complete

Annotations of Ll_transcript_140235

• Blastp: Transcription factor LAX PANICLE from Oryza sativa with 80.95% of identity
• Blastx: Transcription factor LAX PANICLE from Oryza sativa with 80.95% of identity
• Eggnog: Helix-loop-helix DNA-binding domain(ENOG410Z0JU)
• Kegg: Link to kegg annotations (4327431)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465451.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;