Protein coding transcript 130265

• Transcript: Ll_transcript_36666
• CDS coordinates: 82-801 (+)
• Peptide sequence: MSQLNGAYYGPAIPPPPPPRYYHRSDERGCCCNCLCGITKCCCGCIFSIICKIITFFLVLAIIVGVIIWLIVRPNPLKFHVTEANLTEFNYGNNEILDYDLALNVSIRNPNSRLGVYYDEIETTALYDDVKFGSQTLEPFFQRRKTTSYLGPVFKGKQVMSLGENQVSKLNKDKESGVYHIVVKLKMKFRFKFGLIKIGNINPKIRCDLKVPLKSHNGTGQFETTECGWDYRSFFLRKE*
• ORF Type: complete

Annotations of Ll_transcript_36666

• Blastp: NDR1/HIN1-like protein 2 from Arabidopsis with 44.59% of identity
• Blastx: NDR1/HIN1-like protein 3 from Arabidopsis with 48.07% of identity
• Eggnog: harpin-induced protein 1 domain containing protein, expressed(ENOG410YGQV)
• Kegg: Link to kegg annotations (AT3G11650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433866.1)
• Pfam: Late embryogenesis abundant protein (PF03168.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;