Protein coding transcript 130269

• Transcript: Ll_transcript_270437
• CDS coordinates: 1-573 (+)
• Peptide sequence: APSTKDVLQPGSEVVAAGYCLYGSATMMVLSFGQGVNGFMLDPAIGEFVLTEKNMRVPEQGKIYSINEGYTYLWDEAIKEYVRQKKDPACGKPYGARYVGSMVADVHRTLKYGGIFMYPATKDAPKGKLRLMYEAIPMSYLMEQAGGKATNGSKRILDIVPEQIHQRTPVFLGSKNDVEDLLTIIKKHSN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270437

• Blastp: Fructose-1,6-bisphosphatase 1 from Oryctolagus with 64.55% of identity
• Blastx: Fructose-1,6-bisphosphatase 1 from Oryctolagus with 64.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003593121.1)
• Pfam: Fructose-1-6-bisphosphatase, N-terminal domain (PF00316.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;