Protein coding transcript 130270

• Transcript: Ll_transcript_270434
• CDS coordinates: 137-772 (+)
• Peptide sequence: MEPKHPSQFRIFTTSSTVSGAAPRLDRSEYALKEIISHLGGESSKKDKTGSTFDLVEPTQYLYVRVVKARDMALFGGVELFVEVKLGDCKVTTKRSNAEWDQVFAFPIDRIYSSTIEIFVKERNKNNYIGRVMFELRKVPGRVPPNSELEPQWYRMEDKKGDKAKTGDIMLSMWFGIQSDEAFAEAFCSEAPNVHPDVLKPKVYLSPKLWYL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_270434

• Blastp: FT-interacting protein 1 from Arabidopsis with 48.04% of identity
• Blastx: FT-interacting protein 1 from Arabidopsis with 48.04% of identity
• Eggnog: Multiple C2 and transmembrane domain-containing protein(ENOG410XRQN)
• Kegg: Link to kegg annotations (AT5G06850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439059.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;