Protein coding transcript 130274

• Transcript: Ll_transcript_270440
• CDS coordinates: 3-611 (+)
• Peptide sequence: RLGAKVTAVEFMPTIGGVGIDGEVSKQFQKILTKQGLGFKLGTKVISASKSGGQILVEVENAKDSSKKETLDCDVLLVSVGRRPYTQNLGLEENSIEKDAKGRIPVNSRFQTVIPNIFAIGDCIHGPMLAHKAEDEGIVCVEGITGAPVHIDYNCVPSVIYTHPEVAWVGKSEEDLKNEGVDYKVGKFPFAANSRAKTNNETD
• ORF Type: internal

Annotations of Ll_transcript_270440

• Blastp: Dihydrolipoyl dehydrogenase, mitochondrial from Caenorhabditis with 72.41% of identity
• Blastx: Dihydrolipoyl dehydrogenase, mitochondrial from Caenorhabditis with 72.41% of identity
• Eggnog: dihydrolipoyl dehydrogenase(COG1249)
• Kegg: Link to kegg annotations (CELE_LLC1.3)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014508825.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;