Transcript | Ll_transcript_270455 |
---|---|
CDS coordinates | 3-452 (+) |
Peptide sequence | PMEKIQGMFDAFAELPYKVIWKADVDQFPKEVKFAKNIHFVKWMPQLDILCSSNVKLFVSHGGLMGSQEAVHCGVPILGIPLFADQELNIRQAEKVGQAIKVDYNEISKEKILNAAKELLYNQKYQQNANTFSVLFKDRPMSALDTAIYW |
ORF Type | internal |
Blastp | UDP-glucuronosyltransferase 2B14 from Oryctolagus with 39.19% of identity |
---|---|
Blastx | UDP-glucuronosyltransferase 2B14 from Oryctolagus with 39.19% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (100009057) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016186090.1) |
Pfam | UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer