Protein coding transcript 130275

• Transcript: Ll_transcript_270455
• CDS coordinates: 3-452 (+)
• Peptide sequence: PMEKIQGMFDAFAELPYKVIWKADVDQFPKEVKFAKNIHFVKWMPQLDILCSSNVKLFVSHGGLMGSQEAVHCGVPILGIPLFADQELNIRQAEKVGQAIKVDYNEISKEKILNAAKELLYNQKYQQNANTFSVLFKDRPMSALDTAIYW
• ORF Type: internal

Annotations of Ll_transcript_270455

• Blastp: UDP-glucuronosyltransferase 2B14 from Oryctolagus with 39.19% of identity
• Blastx: UDP-glucuronosyltransferase 2B14 from Oryctolagus with 39.19% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100009057)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016186090.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;