| Transcript | Ll_transcript_270416 |
|---|---|
| CDS coordinates | 1-393 (+) |
| Peptide sequence | PRKSDNDVCVNSNPQKTFSNMVLDISITKVSIIVLLTCFLLPSSSQHLNYFSYLIVREKPKSDVDLVEFALNLEYLEAEFFLFGATGQGLDDFAPELAEGGPSPTGAKIASLDKDTKDVILQFALQEVGHL |
| ORF Type | internal |
| Blastp | Desiccation-related protein PCC13-62 from Craterostigma with 44.44% of identity |
|---|---|
| Blastx | Desiccation-related protein PCC13-62 from Craterostigma with 44.44% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463277.1) |
| Pfam | Ferritin-like domain (PF13668.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer