| Transcript | Ll_transcript_62568 |
|---|---|
| CDS coordinates | 157-528 (+) |
| Peptide sequence | MEAIGISGVLRFVIFTNMTFSINSLAHFWGTKPYDTRIKPVQNMALAILTTGEGWHNYHHAFPWDYRAEEYGGNFTNPTTIVLDLFAKIGWAYDCKTPSADLVRQVATKHGDGSWSEVPVEECK |
| ORF Type | 3prime_partial |
| Blastp | Acyl-CoA Delta(11) desaturase from Trichoplusia with 52.34% of identity |
|---|---|
| Blastx | Acyl-CoA Delta(11) desaturase from Trichoplusia with 52.63% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004506950.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer