Protein coding transcript 130286

• Transcript: Ll_transcript_62528
• CDS coordinates: 1-330 (+)
• Peptide sequence: MEVQEFGSDCGYPNQRCVYISYLDSVKYLRPDREAVTGEPLRTFIYHEILIGYLDYCKKRGFVTCYIWSCPPKMGYDYILHCHPETQKIPKACQLRNWYHSMLKKAAKEN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_62528

• Blastp: Histone acetyltransferase HAC5 from Arabidopsis with 72.48% of identity
• Blastx: Histone acetyltransferase HAC5 from Arabidopsis with 72.48% of identity
• Eggnog: histone acetyltransferase activity(ENOG4111K0H)
• Kegg: Link to kegg annotations (AT3G12980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020970725.1)
• Pfam: Histone acetylation protein (PF08214.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;