Protein coding transcript 130293

• Transcript: Ll_transcript_239754
• CDS coordinates: 3-617 (+)
• Peptide sequence: NILVKIESRNPSFSVKCRIGANMIWHAEKNNNINKNVKLIEATSGNTGIALAYVAASRNYRLTLTMPETMSIERKKILKSLGAELILTDGRYGMKGAISKANDIISRNPSKYFLLKQFENPANPEIHQITTGPEIWNDTNGNLDILISAVGTGGTITGITRYIKKIKRKKNLISIAVEPSESPVITQFLAGKAIEPGPHKIQGIG
• ORF Type: internal

Annotations of Ll_transcript_239754

• Blastp: Cysteine synthase from Buchnera with 100% of identity
• Blastx: Cysteine synthase from Buchnera with 100% of identity
• Eggnog: cysteine biosynthetic process from serine(COG0031)
• Kegg: Link to kegg annotations (BU066)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434319.1)
• Pfam: Pyridoxal-phosphate dependent enzyme (PF00291.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;