Protein coding transcript 130302

• Transcript: Ll_transcript_29917
• CDS coordinates: 1-297 (+)
• Peptide sequence: SALPVYIRLSHSDEQKWLEICRRSALLQRNSKFQRIVEQSGGIKNFFLRMTRIDEVKEGKLVGVDKFGNKYYENPMYFMGRNRWVEYSDRYGYDYDGSQ
• ORF Type: internal

Annotations of Ll_transcript_29917

• Blastp: Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 from Caenorhabditis with 43.84% of identity
• Blastx: Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 from Caenorhabditis with 45% of identity
• Eggnog: NADH dehydrogenase (ubiquinone) activity(ENOG4111XVR)
• Kegg: Link to kegg annotations (CELE_Y94H6A.8)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004510176.1)
• Pfam: NADH ubiquinone oxidoreductase subunit NDUFA12 (PF05071.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;