Protein coding transcript 130303

• Transcript: Ll_transcript_29920
• CDS coordinates: 63-518 (+)
• Peptide sequence: MEATMNLSDLCKIGESVYKAKMDGRVLAVKKAKEDVSEELKILQKVNHGNLVKLMGVSSDNDGNFFLVYEYAENGCLDDWMFSKSTSNSMVSLTWSQRISIAVDIAMGLQYMHEHTHPRIVHRDITTSNILIDSNFKAKISNFSMARTSTNP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_29920

• Blastp: Serine/threonine receptor-like kinase NFP from Medicago with 82.35% of identity
• Blastx: Serine/threonine receptor-like kinase NFP from Medicago with 82.66% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_5g019040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420412.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;