| Transcript | Ll_transcript_269519 |
|---|---|
| CDS coordinates | 1-408 (+) |
| Peptide sequence | ALFEMLFADDIIFDVIGCLEYDPTLPIRKYHRHHLKNVSKFKEVILITNLELLNKIHQTHRVQYIQDVVLPTPSVFEDNMLSALSSFIFFNKVEIVTLIQEDEKFLPDLLGQLQDESTPDSRKLELVQFLKEFCNF |
| ORF Type | internal |
| Blastp | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Xenopus with 66.18% of identity |
|---|---|
| Blastx | Serine/threonine-protein phosphatase 4 regulatory subunit 3 from Xenopus with 66.18% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (432127) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003550593.1) |
| Pfam | Component of IIS longevity pathway SMK-1 (PF04802.14) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer