Protein coding transcript 130310

• Transcript: Ll_transcript_269544
• CDS coordinates: 107-1003 (+)
• Peptide sequence: MGKNIPVIDMEKISEEDECKNLREACEKWGCFRIINHSVPQTLMAEMKIVIGALLDLPIEMKERNKEVIAGSGYMAPSKLNPFYESLGLYDLASSQALFDFCYQLDASPHQRQVMETYGKAIHDLAVTIGQKMAQSLGIVCADFEDWPCQFRINKYNFTPEAVGSLGVQLHTDSGFLTILQDDNNVGGLEVMDSSGSFVPIPPLPGSLLANLGDIAQVWSNGRFCNVKHRVQCKEATTRLSIATFMLATRKGNVEAPAELVNHDHHRLYQPFIYEDYRKLRVSNKMHVGEALELLRIV*
• ORF Type: complete

Annotations of Ll_transcript_269544

• Blastp: 2-oxoglutarate-dependent dioxygenase DAO from Oryza sativa with 51.86% of identity
• Blastx: 2-oxoglutarate-dependent dioxygenase DAO from Oryza sativa with 51.86% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (4336150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423910.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;