Protein coding transcript 130322

• Transcript: Ll_transcript_45512
• CDS coordinates: 191-826 (+)
• Peptide sequence: MLRLKNQLPWTAVLSLLLCIGDLEALTFQRATSDPTKCSYGERGSLTATCVNANPSYFKATQYRFDQLDETLRCLNCTLTTLESGTFDLSGNQIKFLDLRNSSVQSVKPKAFVGLIFMEHLSLGNNEISNIFPGSFSGVKKIKTLDLDNNKINSLSDGGFTELINLEKLQLQNNQIAFMPTKAFTGLNNLVELNLQNNRISNVSAFSANLTN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_45512

• Blastp: TLR4 interactor with leucine rich repeats from Homo with 37.96% of identity
• Blastx: TLR4 interactor with leucine rich repeats from Homo with 35.11% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (9865)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014501925.1)
• Pfam: Leucine rich repeats (6 copies) (PF13306.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;