Protein coding transcript 130336

• Transcript: Ll_transcript_179764
• CDS coordinates: 27-431 (+)
• Peptide sequence: MDKEGPKGRGKDESGDVRYRGVRRRPWGKFAAEIRDSTRQGQRVWLGTFNTAEEAARAYDRAAYSMRGSFAILNFPNEYSMPGVGSGGSGGAHSSAASSSSSSSSRHGNVEGREVFEIEYYDDKLLEEMLDYEEK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_179764

• Blastp: Ethylene-responsive transcription factor ERF098 from Arabidopsis with 63.64% of identity
• Blastx: Ethylene-responsive transcription factor ERF098 from Arabidopsis with 63.11% of identity
• Eggnog: ethylene-responsive transcription factor(ENOG410YQAX)
• Kegg: Link to kegg annotations (AT3G23230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439145.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;