Protein coding transcript 130340

• Transcript: Ll_transcript_73812
• CDS coordinates: 33-476 (+)
• Peptide sequence: MAMTMAMVSPWISTTTTTTRSSLSLFTSSRPTLSTTSLSFTSPSPLLHSSFISSSSLSFPSSLSGLSLGLDLASNVGGRGGKRRGLVVRAGKAALCQTKRSRSRKSLARTHGFRRRMRTPGGRAILKRRRAKGRKILCTKTHSHSGK*
• ORF Type: complete

Annotations of Ll_transcript_73812

• Blastp: 50S ribosomal protein L34, chloroplastic from Arabidopsis with 69.31% of identity
• Blastx: 50S ribosomal protein L34, chloroplastic from Spinacia with 83.93% of identity
• Eggnog: ribosomal protein l34(ENOG410Y1JV)
• Kegg: Link to kegg annotations (AT1G29070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426230.1)
• Pfam: Ribosomal protein L34 (PF00468.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;