Protein coding transcript 130341

• Transcript: Ll_transcript_73795
• CDS coordinates: 3-329 (+)
• Peptide sequence: RITCEAVDEYGFETTPYSFLSEATNAKGYFLATLSPLEVTEKWVLKECRAFLDASPLDNCSYATDVNKGSSGAVLHSYHLLHDKNMKLYTVGPFVFTTPPPTSISEGY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_73795

• Blastp: Proline-rich protein 3 from Arabidopsis with 37.62% of identity
• Blastx: Proline-rich protein 3 from Arabidopsis with 35.16% of identity
• Eggnog: NA(ENOG410Y08D)
• Kegg: Link to kegg annotations (AT3G62680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427368.1)
• Pfam: Pollen proteins Ole e I like (PF01190.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;