Protein coding transcript 130344

• Transcript: Ll_transcript_73800
• CDS coordinates: 1-351 (-)
• Peptide sequence: VDKMKKAGNFITLESYNTWLLGLLRNGKLSEARLVLNEMVQNGVEPNIYSYNIMMNGLCRKHMMSDARRLMDLMISNGVYPDTVTYSTLLHGYCSQGKVFEAKNVLREMIRNGCEPN
• ORF Type: internal

Annotations of Ll_transcript_73800

• Blastp: Pentatricopeptide repeat-containing protein At2g17140 from Arabidopsis with 53.45% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g17140 from Arabidopsis with 53.45% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G17140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445608.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;