Transcript | Ll_transcript_73801 |
---|---|
CDS coordinates | 3-320 (+) |
Peptide sequence | IKNVATGTSGSAKDKAGEASEKTSESINEAKERTYQAAQEAKEKINEEANERQRESNEELNWAKEKAKEGYDAAKDTIASNLEAAKQKSHEVKDKLGGQRRDAEL* |
ORF Type | 5prime_partial |
Blastp | Late embryogenesis abundant protein D-29 from Gossypium with 42.39% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418051.1) |
Pfam | Apolipoprotein A1/A4/E domain (PF01442.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer