Protein coding transcript 130347

• Transcript: Ll_transcript_96629
• CDS coordinates: 2-310 (+)
• Peptide sequence: LLDDPLSAVDVHVATHLFDKCINGYLKDKTRILVTHQVYLLKNVDKIIILNNGRVDMEGSFDDLSKSDNLYGQLCKMEPEQTQVVDEKAENMKMPRKMSTRSA
• ORF Type: internal

Annotations of Ll_transcript_96629

• Blastp: ABC transporter C family member 11 from Arabidopsis with 42.55% of identity
• Blastx: ABC transporter C family member 11 from Arabidopsis with 42.55% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT1G30420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014518272.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;