Protein coding transcript 130352

• Transcript: Ll_transcript_96649
• CDS coordinates: 2-430 (+)
• Peptide sequence: RNDSIICNIGHFDCEIEVTWLDKNAVEKINIKPQVDRYKLPNGHHVILLAEGRLVNLGCAMGHPSFVMSNSFTNQTLAQIELWTKPGHYSIGVHMLPKKLDEEVAALHLDHLGVKLTKLNADQASYLGIPAEGPFKPDHYRY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_96649

• Blastp: Adenosylhomocysteinase from Anopheles with 80.99% of identity
• Blastx: Adenosylhomocysteinase from Anopheles with 80.99% of identity
• Eggnog: May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine (By similarity)(COG0499)
• Kegg: Link to kegg annotations (AgaP_AGAP000719)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017434934.1)
• Pfam: S-adenosyl-L-homocysteine hydrolase, NAD binding domain (PF00670.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;