Protein coding transcript 130353

• Transcript: Ll_transcript_96627
• CDS coordinates: 3-458 (-)
• Peptide sequence: SDTRSCRQISKNVSNYGSNENVRLFDIDEGKRCYNLPTTKNEVYLIRGIFPFGELSNSSFYVTIGVTQLGSVISSRLQDLEIEGVFRATKSYIDFCLVKEKVNPYISQLELRPLPEEYIHGLPTSVLKLISRNNLKGEGDDTRYAIYFTLR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_96627

• Blastp: Nodulation receptor kinase from Medicago with 72.92% of identity
• Blastx: Nodulation receptor kinase from Medicago with 72.92% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_5g030920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420942.1)
• Pfam: Carbohydrate-binding protein of the ER (PF12819.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;