Protein coding transcript 130358

• Transcript: Ll_transcript_96662
• CDS coordinates: 135-458 (-)
• Peptide sequence: PPEFQSLSALLIQEILPVVKFSDMEEPAAETCAVCLYEFEPDEEIRRLTNCCHIFHKGCLDRWMGYDQRTCPMCRTPFIPYHMQTTFDERLWLASRVPRFNSQIEIC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_96662

• Blastp: Probable E3 ubiquitin-protein ligase RHA1A from Arabidopsis with 41% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RHA1A from Arabidopsis with 41.58% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G11370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423309.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;