Protein coding transcript 130362

• Transcript: Ll_transcript_253712
• CDS coordinates: 163-1128 (+)
• Peptide sequence: MKLAGLKSVDNAHDDSVWAVTWVPATANRPPLLLTGSLDETVRLWRSDDLVLERTNTGHCLGVASVAAHPLGSIAASSSLDSFVRVFDVDSNATVATLEAPPSEVWQMRFDPKGAFLAVAGGGSASVKIWDTTTWELFVTLSIPRPEGSKPTDKSGSKKFVLSVAWSPDGKRLACGSMDGTISVFDVLRAKFLHHLEGHFMPVRSLVYSPYDPRLLFSASDDGNVHMYDAEGKALIGTMSGHSSWVLCVDVSPDGGAIATGSSDRTVRLWDLNMRASVQTMGNHTDQVWGVAFRPPGGTDVRNGRLASVSDDKSISLYDYS*
• ORF Type: complete

Annotations of Ll_transcript_253712

• Blastp: WD repeat-containing protein VIP3 from Arabidopsis with 78.82% of identity
• Blastx: WD repeat-containing protein VIP3 from Arabidopsis with 78.82% of identity
• Eggnog: wD repeat domain(ENOG410XP1Z)
• Kegg: Link to kegg annotations (AT4G29830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463682.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;