Protein coding transcript 130363

• Transcript: Ll_transcript_253743
• CDS coordinates: 2-409 (+)
• Peptide sequence: FHTECSKVFEELEAIVDKLATDSQRGSYSIKKTNGASLPRPTSLKNSSPLIVNNTSTLNSARGASTENLPAGVLYRVKATYKYNREDVDELSFEVGEVINVIEYDDPEEQEEGWLMGAKENGEKGMFPANFTRPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_253743

• Blastp: Myc box-dependent-interacting protein 1 from Homo with 38.61% of identity
• Blastx: Myc box-dependent-interacting protein 1 from Homo with 38.61% of identity
• Eggnog: Bridging integrator 1(ENOG410XQXT)
• Kegg: Link to kegg annotations (274)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013457667.1)
• Pfam: Variant SH3 domain (PF07653.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;