Protein coding transcript 130372

• Transcript: Ll_transcript_121603
• CDS coordinates: 161-805 (+)
• Peptide sequence: MAPKPVFHLPLLFLVLFFSSTTESLRFELESGATKCISEDINNNAMTVGTYSVVNHNEGHPLPESHKVTVKVTSTFGNIYHQADAVQTGKFAFYAGESGDHVACFTAAEHTPKVTLTVEFVWKSGVQAKDWSTVAKKGQVDVMELEVKKLIESADEIYKEMAHIRASADDTHELNRVTNDRMFWFSFLSIFVCLSVAGLQLWHLKTFFEKKKLI*
• ORF Type: complete

Annotations of Ll_transcript_121603

• Blastp: Transmembrane emp24 domain-containing protein p24delta9 from Arabidopsis with 58.82% of identity
• Blastx: Transmembrane emp24 domain-containing protein p24delta9 from Arabidopsis with 59.18% of identity
• Eggnog: vesicle-mediated transport(ENOG410XTBQ)
• Kegg: Link to kegg annotations (AT1G26690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432158.1)
• Pfam: emp24/gp25L/p24 family/GOLD (PF01105.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;