Protein coding transcript 130374

• Transcript: Ll_transcript_121591
• CDS coordinates: 3-335 (-)
• Peptide sequence: VSSSKPYKEEKTCDLSKGHWVPSLDGLSSYYTNSSCTTISDSKNCFKQGRKDSDFLNWKWKPDECDLPRFDPRIFLNMVRGKTMAFIGDSVARNHMDSLVCILSSQVNVKL
• ORF Type: internal

Annotations of Ll_transcript_121591

• Blastp: Protein ALTERED XYLOGLUCAN 4-like from Arabidopsis with 70.41% of identity
• Blastx: Protein ALTERED XYLOGLUCAN 4-like from Arabidopsis with 70.41% of identity
• Eggnog: Pfam:DUF231(ENOG410YEWI)
• Kegg: Link to kegg annotations (AT3G28150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451649.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;