Protein coding transcript 130376

• Transcript: Ll_transcript_130132
• CDS coordinates: 67-1113 (+)
• Peptide sequence: MSSPPPLSLNVVGSDTFNPLPTSRRSSSPLKNLSPTILIIVTVLAVTVIVSLSICFLIRHLNRRCLRRLTHSSSAVPSSAAATPIFTSSRRISPEIPPSSIIDSLPLFTFSSVTRRSATGAADCAVCLSKFQDHDLLRLLPLCCHAFHAECIDTWLQSNLSCPLCRSAIVAADNDLAKILRSSSSAGSDSFRVEIGNVSRRGTATATAPEDSVSSAADDARSGGAGTRSYSIGSFEYLVNEDSEVPFSNAHRRSVSDQKDIPFPADFPVTQNEAFLAGDVAGVRNWLKDYVDRISASISSRTVSFRSSGRFGGSSRRSDVVPVSVDYDIEGNRIGEEISEMFRWISGV*
• ORF Type: complete

Annotations of Ll_transcript_130132

• Blastp: E3 ubiquitin-protein ligase ATL4 from Arabidopsis with 48.94% of identity
• Blastx: E3 ubiquitin-protein ligase ATL4 from Arabidopsis with 44.22% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G60220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412674.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;