Transcript | Ll_transcript_217222 |
---|---|
CDS coordinates | 1-333 (+) |
Peptide sequence | LLSTLTMASSLIQLHCSTLSLTSNPSILPPRPSVTSFLTKPIGKSRLQAHIPRQVFPVRALTYDGGFGSEDKASGSDDEVSGVAVVEEEKTEVEKVKKLLVDSLYGTDRGL |
ORF Type | internal |
Blastp | Chromoplast-specific carotenoid-associated protein, chromoplastic from Cucumis with 38.98% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (101203857) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425196.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer