Protein coding transcript 130385

• Transcript: Ll_transcript_217206
• CDS coordinates: 1-693 (+)
• Peptide sequence: PEFSKYESFGTLVDYPLYFGTTLFSLQAVGVVIALENNMATPKSFLGPFGVLNIGMGLVTVIYVGMGMMGYWQYGKDIKASVTLNFPPADYLAQAINIMYSIAIYISYGLQGFVPVQLLWSNYIVQRLEDSQHKLRWEYLLRFGCVVVTFVLAMTIPLLGLFISLVGSFCLSALGIAFPAIIELCAYWPDKLGPCRYVLFKDILLIIIGVVGLLAGSYSAILAIVTELTK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_217206

• Blastp: Proton-coupled amino acid transporter-like protein CG1139 from Sophophora with 42.48% of identity
• Blastx: Proton-coupled amino acid transporter-like protein CG1139 from Sophophora with 42.67% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (Dmel_CG1139)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444175.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;