Protein coding transcript 130389

• Transcript: Ll_transcript_217183
• CDS coordinates: 21-362 (-)
• Peptide sequence: MFGYEENKIYNMEDDEDAFAIAKTMPQLMYLQLYGNRITNVGLLAILKGCPCLKWVHIIWCPYLNLQCSLLERCVKGLEFFRAETGMPPRGKQWWQWDPKIDKHSYYTYIFNF*
• ORF Type: complete

Annotations of Ll_transcript_217183

• Blastp: Putative F-box/LRR-repeat protein 21 from Arabidopsis with 42.68% of identity
• Blastx: Putative F-box/LRR-repeat protein 21 from Arabidopsis with 37.34% of identity
• Eggnog: F-box and leucine-rich repeat protein(ENOG410XQ54)
• Kegg: Link to kegg annotations (AT4G05470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003541669.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;