Protein coding transcript 130396

• Transcript: Ll_transcript_217219
• CDS coordinates: 1-372 (+)
• Peptide sequence: LIREYTRFVSEDLKMRYVAAYLLAVLGGKASPAQGDLEKILGSVGIEIDQTKLQKVIKDLNGKSIDELIAQGREKLSSMPVGGGAAPAAAAAAPAAEEKKDSKKEEKKAESEEEEDDDMGFGLF
• ORF Type: internal

Annotations of Ll_transcript_217219

• Blastp: 60S acidic ribosomal protein P2 from Sophophora with 76.92% of identity
• Blastx: 60S acidic ribosomal protein P2 from Sophophora with 76.92% of identity
• Eggnog: Ribosomal protein(COG2058)
• Kegg: Link to kegg annotations (Dmel_CG4918)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436328.1)
• Pfam: 60s Acidic ribosomal protein (PF00428.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;