Protein coding transcript 130397

• Transcript: Ll_transcript_217204
• CDS coordinates: 3-458 (+)
• Peptide sequence: GHRQDIVPQELVELFVSMTNPPHAHMTDIEIALHCAFSLPAVALTLGRENWGFLRGTYERLAADMQWKVRKTVACSVHELAEILGEELTAKDLVPIYTGFIKDLDEVRIGALKHLADFVKLLPNSKRKSFLSQFEMFLVTDNEWNWRFREEL
• ORF Type: internal

Annotations of Ll_transcript_217204

• Blastp: Serine/threonine-protein phosphatase 4 regulatory subunit 1 from Homo with 66.44% of identity
• Blastx: Serine/threonine-protein phosphatase 4 regulatory subunit 1 from Homo with 66.44% of identity
• Eggnog: phosphatase 4, regulatory subunit(ENOG410XQII)
• Kegg: Link to kegg annotations (9989)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455383.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;