Protein coding transcript 1304

• Transcript: Ll_transcript_358609
• CDS coordinates: 3-383 (+)
• Peptide sequence: NLKRIEQTSAALAAADDWFLAYAPIGRNSSVLPPVSSISNLTSSQPKLSSSAHKFNSMVQELFEDVGPLEVLQLDGLAFEGLLQVFSSYVNLLINALPATAVTENLEGSGSKIVKIAETESQQIALL
• ORF Type: internal

Annotations of Ll_transcript_358609

• Blastp: Exocyst complex component EXO84A from Arabidopsis with 61.29% of identity
• Blastx: Exocyst complex component EXO84A from Arabidopsis with 61.29% of identity
• Eggnog: Exocyst complex component(ENOG410XT7U)
• Kegg: Link to kegg annotations (AT1G10385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422854.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;