Protein coding transcript 130413

• Transcript: Ll_transcript_250971
• CDS coordinates: 1-450 (+)
• Peptide sequence: ADHYYQFTYHTPITKPTTTLQSSLLRKFQAHISTSPKLFGLYTLVITGAISLLLSGLTFILIGTILGLTILMPLIILSSPIWVPAFTVLFFVIAGFLSLCVFGVVVVVAVFSLMCRYFRGSSYTDQTVWTTHKLAPRAMSEYGREYVSY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_250971

• Blastp: Oleosin 14.9 kDa from Arabidopsis with 31.21% of identity
• Blastx: -
• Eggnog: Oleosin(ENOG41103SU)
• Kegg: Link to kegg annotations (AT5G51210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013442458.1)
• Pfam: Oleosin (PF01277.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;