| Transcript | Ll_transcript_250981 |
|---|---|
| CDS coordinates | 191-571 (+) |
| Peptide sequence | MDLSLDELIKSKRSTSRGGRRGGGRQGGSRGGGVKRGGGGGGGSNFRSNGAGGGGGGPIRRGRPMARRSNGFSPYSKGDVNGSWTHDMYEGPKRQQMRGGLSTTNIHKIVISNLDFGVTSTDIQELF |
| ORF Type | 3prime_partial |
| Blastp | Aly/REF export factor 2 from Mus with 32.31% of identity |
|---|---|
| Blastx | - |
| Eggnog | Polymerase (DNA-directed), delta interacting protein 3(ENOG4111JAW) |
| Kegg | Link to kegg annotations (56009) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017425434.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer