Protein coding transcript 130419

• Transcript: Ll_transcript_272083
• CDS coordinates: 62-772 (+)
• Peptide sequence: MEEAILIETEVQLTTSFSHTTMASTTSSPSSTQGATNYEKKIQHEKLGNDIGNKKKNKVVNSNSKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTADMAARAHDVAALAIKGSSAYLNFPELVGELPRPASKSPKDIQAAAAKAAMINYRHDKSHEAKCEVDAQSSQTKSSSYQMNSSTNGEDDMFLDLPDLSLNLNHCCIDEFHYSSTWLITGAEHFDSGFQEPLLWDLY*
• ORF Type: complete

Annotations of Ll_transcript_272083

• Blastp: Ethylene-responsive transcription factor ERF034 from Arabidopsis with 49.52% of identity
• Blastx: Ethylene-responsive transcription factor ERF034 from Arabidopsis with 50.5% of identity
• Eggnog: Transcription factor(ENOG410YIZG)
• Kegg: Link to kegg annotations (AT2G44940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446074.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;