Protein coding transcript 130422

• Transcript: Ll_transcript_272097
• CDS coordinates: 94-414 (+)
• Peptide sequence: MSMAGLDLGTASRYAQNLHRESLHHHQHHHHDSEKQDHHNHHHRGADADAFSTEEDDKSQGLELGSASGGGPDDVIGRRPRGRPPGSKNKAKPPVIITRESANTLRA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_272097

• Blastp: AT-hook motif nuclear-localized protein 21 from Arabidopsis with 39.47% of identity
• Blastx: AT-hook motif nuclear-localized protein 23 from Arabidopsis with 46.61% of identity
• Eggnog: DNA-binding protein ESCAROLA-like(ENOG410YG7Z)
• Kegg: Link to kegg annotations (AT2G35270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420536.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;