Transcript | Ll_transcript_272097 |
---|---|
CDS coordinates | 94-414 (+) |
Peptide sequence | MSMAGLDLGTASRYAQNLHRESLHHHQHHHHDSEKQDHHNHHHRGADADAFSTEEDDKSQGLELGSASGGGPDDVIGRRPRGRPPGSKNKAKPPVIITRESANTLRA |
ORF Type | 3prime_partial |
Blastp | AT-hook motif nuclear-localized protein 21 from Arabidopsis with 39.47% of identity |
---|---|
Blastx | AT-hook motif nuclear-localized protein 23 from Arabidopsis with 46.61% of identity |
Eggnog | DNA-binding protein ESCAROLA-like(ENOG410YG7Z) |
Kegg | Link to kegg annotations (AT2G35270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420536.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer