Transcript | Ll_transcript_272049 |
---|---|
CDS coordinates | 1-600 (-) |
Peptide sequence | MGIEKHPFVSSLSLLFIFAYSASAFHSSFSPTVNYLIDCGSTNKTKLKDGRTFKSDRETTSLLDTTEDIQASVNSINITNKLSSSSLPLYQTARVFTEESTYIFYISKTGRLWIRLYFLPLPHPSYNLTTAVFSVHTNHLVLLHEFSVTKNDTLVFKEYLVNVSDSRFSLKFKPMKDSLAFINAIEVVSAPDTLISDTAT |
ORF Type | 3prime_partial |
Blastp | Probable receptor-like protein kinase At5g61350 from Arabidopsis with 58.05% of identity |
---|---|
Blastx | Probable receptor-like protein kinase At5g61350 from Arabidopsis with 57.65% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G61350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438485.1) |
Pfam | Di-glucose binding within endoplasmic reticulum (PF11721.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer