Protein coding transcript 130424

• Transcript: Ll_transcript_272049
• CDS coordinates: 1-600 (-)
• Peptide sequence: MGIEKHPFVSSLSLLFIFAYSASAFHSSFSPTVNYLIDCGSTNKTKLKDGRTFKSDRETTSLLDTTEDIQASVNSINITNKLSSSSLPLYQTARVFTEESTYIFYISKTGRLWIRLYFLPLPHPSYNLTTAVFSVHTNHLVLLHEFSVTKNDTLVFKEYLVNVSDSRFSLKFKPMKDSLAFINAIEVVSAPDTLISDTAT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_272049

• Blastp: Probable receptor-like protein kinase At5g61350 from Arabidopsis with 58.05% of identity
• Blastx: Probable receptor-like protein kinase At5g61350 from Arabidopsis with 57.65% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G61350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438485.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;