Protein coding transcript 130425

• Transcript: Ll_transcript_272051
• CDS coordinates: 1-309 (-)
• Peptide sequence: RWCSSIALILTVVFGTVHGGNVTYDGRSLIINGEHKILFFGSIHYPRSTPEMWPDLIAKAKEGGLDGIQTYVFWNLHEPQQGQYDFSGGRDLVKFIKEIQAHG
• ORF Type: internal

Annotations of Ll_transcript_272051

• Blastp: Beta-galactosidase 16 from Arabidopsis with 71.43% of identity
• Blastx: Beta-galactosidase 16 from Arabidopsis with 71.43% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT1G77410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416184.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;