Protein coding transcript 130426

• Transcript: Ll_transcript_272057
• CDS coordinates: 1-597 (+)
• Peptide sequence: GKEHLVYKLNKALYGLKQAPRAWNKRIDSFMDKLNFQKCLVKHGVYVKSGQQGELLIICLYVDDILVTGSSSEAIEEFKSVMKAEFDMTDLGKLSYFLGMKFAYTSAGLLMHQKKYATEILAKFHMSSCNPVNTPTEANPRLAIDQEEEAVDETKFKQIFGSLRYLCNSRPNIEFGVGLIRRFMCHPKKTHLLAAKRIL
• ORF Type: internal

Annotations of Ll_transcript_272057

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.46% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.46% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017416455.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;