Transcript | Ll_transcript_272096 |
---|---|
CDS coordinates | 3-449 (+) |
Peptide sequence | LMLKAYLDNQTATDQGSYTYWNKRSTNPCEWTGISCTNMRVVGIDLSSNDIAGKLFANFSMLTELTHLDLSSNTLSGEIPQDLRQCYKLLHLNLSHNILTGELNLSGLTSLRTLDLSTNRMDGDIGLNFPSFCESLVTLNVSGNNLTGR |
ORF Type | internal |
Blastp | Probable LRR receptor-like serine/threonine-protein kinase At1g74360 from Arabidopsis with 55.92% of identity |
---|---|
Blastx | Probable LRR receptor-like serine/threonine-protein kinase At1g74360 from Arabidopsis with 55.92% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G74360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464767.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer