Protein coding transcript 130432

• Transcript: Ll_transcript_272096
• CDS coordinates: 3-449 (+)
• Peptide sequence: LMLKAYLDNQTATDQGSYTYWNKRSTNPCEWTGISCTNMRVVGIDLSSNDIAGKLFANFSMLTELTHLDLSSNTLSGEIPQDLRQCYKLLHLNLSHNILTGELNLSGLTSLRTLDLSTNRMDGDIGLNFPSFCESLVTLNVSGNNLTGR
• ORF Type: internal

Annotations of Ll_transcript_272096

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g74360 from Arabidopsis with 55.92% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g74360 from Arabidopsis with 55.92% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G74360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464767.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;