Protein coding transcript 130433

• Transcript: Ll_transcript_66852
• CDS coordinates: 3-413 (+)
• Peptide sequence: EDKLSSLHDYILLHIMGFLRTKHAVRTCVLSKRWEHLWKSLTSFKFDSSNFQNVVQFREFLSSFLSHRDRSISLENISFRHPGYIGDEILNSFIEHVVSHGIQQLTLDTKFEKLPPCIFSCETLTFLKISSPSTPFK
• ORF Type: internal

Annotations of Ll_transcript_66852

• Blastp: F-box/FBD/LRR-repeat protein At5g53840 from Arabidopsis with 33.33% of identity
• Blastx: F-box/FBD/LRR-repeat protein At5g53840 from Arabidopsis with 33.33% of identity
• Eggnog: F-box FBD LRR-repeat protein(ENOG411188E)
• Kegg: Link to kegg annotations (AT5G53840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462865.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;