Protein coding transcript 130435

• Transcript: Ll_transcript_66853
• CDS coordinates: 1-378 (+)
• Peptide sequence: VIMKLQIVLLIVVFVAAYAAPQNKYTSKYDNIDLDSIFKSDRLLSNYINCLMDRGRCTPDAMELKIVLPDALQNDCAKCSEEQQKSGKKVVNFMIKNKPNEWKELEQKYDPEGIYKKKYDEEIKH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_66853

• Blastp: Ejaculatory bulb-specific protein 3 from Sophophora with 58.16% of identity
• Blastx: Ejaculatory bulb-specific protein 3 from Sophophora with 58.16% of identity
• Eggnog: protein serine threonine kinase(ENOG4111U5H)
• Kegg: Link to kegg annotations (Dmel_CG11390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015970847.1)
• Pfam: Insect pheromone-binding family, A10/OS-D (PF03392.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;