| Transcript | Ll_transcript_66857 |
|---|---|
| CDS coordinates | 1-312 (+) |
| Peptide sequence | QLCKTVDVTVFGVASKTKHEALKGTIDHLLERGSDYAAEVRKVSPEGVDLFLDCVCGEECSRGYSLLKPMGKYILFGSSNIVTGETKSFFSAAKSWWQVDKISP |
| ORF Type | internal |
| Blastp | Synaptic vesicle membrane protein VAT-1 homolog-like from Mus with 63.81% of identity |
|---|---|
| Blastx | Synaptic vesicle membrane protein VAT-1 homolog-like from Mus with 63.81% of identity |
| Eggnog | alcohol dehydrogenase(COG0604) |
| Kegg | Link to kegg annotations (270097) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014515877.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer