Protein coding transcript 130438

• Transcript: Ll_transcript_66858
• CDS coordinates: 3-350 (+)
• Peptide sequence: VLFHQNQSEYVANIFDKVIGLWKDGKVKPVIDSTWAFEDVGEAMQKMHDRKNIGKIVLDPSLEPKPKPATPVKGKSKNADKEKEKKEEDSSANGTTTPEATSPTTKEKEKEKESS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_66858

• Blastp: Synaptic vesicle membrane protein VAT-1 homolog-like from Mus with 49.28% of identity
• Blastx: Synaptic vesicle membrane protein VAT-1 homolog-like from Mus with 49.28% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (270097)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001240244.1)
• Pfam: Zinc-binding dehydrogenase (PF13602.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;