Protein coding transcript 130443

• Transcript: Ll_transcript_82962
• CDS coordinates: 3-839 (+)
• Peptide sequence: NKQLIVGAAIGTREDDKARLALLAQAGVDVVVLDSSQGNSIYQIDMIKFIKTTYPNLQVIAGNVVTVKQAKNLIDAGADALRVGMGSGSICITQEVMAVGRAQATAVYKVSQYAKQYGVPVIADGGIQSIGHIIKALSLGASTVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSIEAMDKKDAMGSAMSRYFHNEVDKLKVAQGVSGSIVDKGSVLRFVPYLQCGIRHSCQDIGTKSLKDLRVMMYSGDLRFELRSNSAQMEGNVHSLFSYEKRLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_82962

• Blastp: Inosine-5'-monophosphate dehydrogenase from Sophophora with 78.78% of identity
• Blastx: Inosine-5'-monophosphate dehydrogenase from Sophophora with 78.78% of identity
• Eggnog: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0516)
• Kegg: Link to kegg annotations (Dmel_CG1799)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017425348.1)
• Pfam: IMP dehydrogenase / GMP reductase domain (PF00478.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;