Protein coding transcript 130446

• Transcript: Ll_transcript_82977
• CDS coordinates: 24-392 (+)
• Peptide sequence: MSQAAKTAARQVKPILSLNKEEARKRVLNLYKAWHRQLPYIVKQYDIPKNIPQCREKLREEFTKYNNIQDVRVVDMLVIKGQMELKEVVEVWKQKGHIMTYFKESQEPKPKDFISKFLAGVN*
• ORF Type: complete

Annotations of Ll_transcript_82977

• Blastp: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 from Bos with 49.17% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 from Bos with 49.18% of identity
• Eggnog: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone(ENOG4111S2F)
• Kegg: Link to kegg annotations (327670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017433100.1)
• Pfam: Complex 1 protein (LYR family) (PF05347.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;