Protein coding transcript 130447

• Transcript: Ll_transcript_27801
• CDS coordinates: 2-340 (+)
• Peptide sequence: KPELTPVAIQAGKLLAQRLYNNGKTDMDYENVATTVFTPLEYGCCGLSEETAIERFGEDKIEVYHAFYKPTEFFVPQRSPARCYMKVVCLRNSPQKVLGMHYIGPQGGEVIQG
• ORF Type: internal

Annotations of Ll_transcript_27801

• Blastp: Thioredoxin reductase 2, mitochondrial from Bos with 66.37% of identity
• Blastx: Thioredoxin reductase 2, mitochondrial from Bos with 66.37% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (282389)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004495142.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;