Transcript | Ll_transcript_27801 |
---|---|
CDS coordinates | 2-340 (+) |
Peptide sequence | KPELTPVAIQAGKLLAQRLYNNGKTDMDYENVATTVFTPLEYGCCGLSEETAIERFGEDKIEVYHAFYKPTEFFVPQRSPARCYMKVVCLRNSPQKVLGMHYIGPQGGEVIQG |
ORF Type | internal |
Blastp | Thioredoxin reductase 2, mitochondrial from Bos with 66.37% of identity |
---|---|
Blastx | Thioredoxin reductase 2, mitochondrial from Bos with 66.37% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (282389) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004495142.1) |
Pfam | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer